PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.JGT0L
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 115aa    MW: 13141 Da    PI: 9.3103
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.JGT0LgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.81.2e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++++G g+W++ +++ g+ R++k+c++rw +yl
      Aradu.JGT0L 14 KGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLERCGKSCRLRWTNYL 61
                     79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-26564IPR009057Homeodomain-like
PROSITE profilePS5129424.287965IPR017930Myb domain
SMARTSM007178.0E-151363IPR001005SANT/Myb domain
PfamPF002492.0E-171461IPR001005SANT/Myb domain
SuperFamilySSF466898.24E-241588IPR009057Homeodomain-like
CDDcd001675.81E-121661No hitNo description
PROSITE profilePS500904.28662101IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.7E-86587IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
MGRSPCCDKV GLKKGPWTPE EDQKLLAYIE EHGHGSWRAL PAKAGLERCG KSCRLRWTNY  60
LRPDIKRGKF SLQEEQAIIQ LHALLGNSTV INIQEHLINS RVVSYSHTFA KEDRQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-161287579B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016194299.19e-59PREDICTED: transcription factor MYB35-like
SwissprotQ7XBH41e-46MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLA0A0L9U1Y61e-58A0A0L9U1Y6_PHAAN; Uncharacterized protein
TrEMBLA0A0S3RRY01e-58A0A0S3RRY0_PHAAN; Uncharacterized protein
STRINGGLYMA19G02890.11e-57(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.16e-59myb domain protein 16